PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC372_p2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family SBP
Protein Properties Length: 764aa    MW: 85214.4 Da    PI: 7.2656
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC372_p2genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP109.81.7e-34144217477
                STT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
        SBP   4 vegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                v +C++d+se+k yhrrh+vC ++++a++v+++g+ +r+CqqC++fh l +fDe+krsCrr+L++hn+rr++k 
  RrC372_p2 144 VARCQVDISELKGYHRRHRVCLQCANATSVVLEGEDKRYCQQCGKFHVLPDFDEGKRSCRRKLERHNNRRKRKP 217
                889*******************************************************************9975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5114126.538139216IPR004333Transcription factor, SBP-box
Gene3DG3DSA:4.10.1100.108.5E-25144203IPR004333Transcription factor, SBP-box
PfamPF031102.7E-25144215IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.31E-30144219IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 764 aa     Download sequence    Send to blast
MSSLSQSQSQ SQSPPEMQIQ PPALLDDDDP SSSAMWDWGD LLLDFAADER LLVSLDSDQP  60
PFSPAPPPMI ATSQPPAQSE SYPSPDESVS GSGSDRVRKR DPRLLCSNFV EGLLPCSCPE  120
LDQKLEEAEL PKKKRVRGGG VSGVARCQVD ISELKGYHRR HRVCLQCANA TSVVLEGEDK  180
RYCQQCGKFH VLPDFDEGKR SCRRKLERHN NRRKRKPVDK GGGVASKQHQ NDNSVIDVDD  240
GKADNGCSSD QRVEQEASLN FEDRRIPTQG SVPFTHTINA DSFMKELMTQ SLNVHLPVVT  300
TKVLTQLCAP QVGSLSNSTI GIQPSSRGDY IFQWLATMPV ELEGYIRPGC TILTVFIAMP  360
EIMWAKQLSK DPVAYLDEFI LKPGKMLFGR GSMTVYLNNM IFRGTTLRRV DVKLESPKLQ  420
FVYPTCFEAG KPIELVVCGL NLVQPKCRYY LPHNYSVVPS RGQDGKRSCN NKLYRINIVN  480
SDPNLFGPAF VEVENESGLS NFIPLIIGDK AICSEMKVIE QKFNATLFPE EQGITACCSL  540
TCCCRDFKER QSTFTGLLLD IAWSVKVPST ECTEQPVNRC QIKRYNRVLN YLIQSNSPSI  600
LGNVLHNLET LVKKMKPDSL VHCTCDCDVR LLHENMNTAR KQQSHVDSKV NPVTSVCCCD  660
SSFQKDIPSR VLNFNQVPET GLGCDERIRA ASPDTGRKET DLLLNNEVIM NVNDIGDWPR  720
KSCIPIQSAQ TFRSRQTVLF IATIAVCFAV CAVLYHPNKV TQLA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul5_A1e-41144222386squamosa promoter binding protein-like 7
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3535520.0AK353552.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-52-E05.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013612712.10.0PREDICTED: squamosa promoter-binding-like protein 7 isoform X1
SwissprotQ8S9G80.0SPL7_ARATH; Squamosa promoter-binding-like protein 7
TrEMBLA0A078DVY30.0A0A078DVY3_BRANA; BnaA10g16180D protein
STRINGscaffold_601959.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM63582644
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G18830.10.0squamosa promoter binding protein-like 7